PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00018514001
Common NameGSBRNA2T00018514001, LOC106427941
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family CO-like
Protein Properties Length: 367aa    MW: 40407.6 Da    PI: 6.1729
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00018514001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box21.64.4e-07444539
             zf-B_box  5 kCpeHeekelqlfCedCqqllCedClleeHkg......Htv 39
                         +C+ ++e++   +C+++  +lC +C  ++H+       H++
  GSBRNA2T00018514001  4 MCDFCGEQRSMVYCRSDAACLCLSCDRSIHSAnalskrHSR 44
                         6*****************************65677777765 PP

2zf-B_box231.6e-074694441
             zf-B_box  4 rkCpeHeekelqlfCedCqqllCedClleeHkg...........Htvvp 41
                          +C++++ ++++  C + ++ lC++C  ++H++           H++++
  GSBRNA2T00018514001 46 LVCERCNAQPATVRCVEERVSLCQNCDWSGHNNnnnnsnslsshHKRQS 94
                         68*****************************888888888888887765 PP

3CCT60.84.5e-21309352144
                  CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                          R++a++RYkeK+k RkF+K++rY+sRKa+A+ R RvKGrF k+ 
  GSBRNA2T00018514001 309 RNNAVMRYKEKKKARKFDKTVRYASRKARADVRRRVKGRFIKAG 352
                          99**************************************9975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS501199.712147IPR000315B-box-type zinc finger
CDDcd000211.55E-7447No hitNo description
SMARTSM003365.9E-9447IPR000315B-box-type zinc finger
PROSITE profilePS501199.0154395IPR000315B-box-type zinc finger
CDDcd000214.48E-44775No hitNo description
SMARTSM003360.54895IPR000315B-box-type zinc finger
PfamPF062034.0E-16309351IPR010402CCT domain
PROSITE profilePS5101715.08309351IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 367 aa     Download sequence    Send to blast
MGYMCDFCGE QRSMVYCRSD AACLCLSCDR SIHSANALSK RHSRTLVCER CNAQPATVRC  60
VEERVSLCQN CDWSGHNNNN NNSNSLSSHH KRQSISCYSG CPSSSELASL WSFCSDLSGS  120
VCEQEMGMMN IDDDGQTNQN CNEAKKDVIV GSSSRLETSY AAHANSSFAK DIGVCEDDFY  180
DNLGMDEVDL ALENYEELFG TAFNSSGHLF GQCGIDSLFQ KHQAAPEGGN SVQPAESNDS  240
FMSSKTEPII CYTSKPAHSN ISFSGVTGES CAGDFQECGA SSSMQLLGDP PWYPQTSQDN  300
NAFSHSVTRN NAVMRYKEKK KARKFDKTVR YASRKARADV RRRVKGRFIK AGEAYDYDPL  360
TPTRSY*
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00018514001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013724116.10.0PREDICTED: zinc finger protein CONSTANS-LIKE 9
RefseqXP_013724117.10.0PREDICTED: zinc finger protein CONSTANS-LIKE 9
RefseqXP_013724118.10.0PREDICTED: zinc finger protein CONSTANS-LIKE 9
SwissprotQ9SSE50.0COL9_ARATH; Zinc finger protein CONSTANS-LIKE 9
TrEMBLA0A078G6N00.0A0A078G6N0_BRANA; BnaC01g39760D protein
STRINGBra040020.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM16822786
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G07650.40.0CONSTANS-like 9
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]